SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37519887|ref|NP_923264.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|37519887|ref|NP_923264.1|
Domain Number - Region: 228-299
Classification Level Classification E-value
Superfamily PLP-binding barrel 0.0641
Family Alanine racemase-like, N-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37519887|ref|NP_923264.1|
Sequence length 304
Comment hypothetical protein glr0318 [Gloeobacter violaceus PCC 7421]
Sequence
MAEQERRPFDTSLQGLAALYSRHFLAWLKGPEVTWEQELNSVIVAQQRRADFLIRYRDEQ
AEARLLHVEFQTLVQKGEPREELPVRMATYALFVLNRYGLLPNQVLVLLKDSAATRQVPE
RFEQGRVRVEYDLVRLWEQDPEPVLASGLVGLMPLVPLMRGQELGALLEACTGVIEAEIE
SSQQRTEVLTVTGLLASLRDTQVVTEFFRRRSQMSLLTETPLFQELTRELVQQAVQQAVH
ETEQRTRLQFLLHQLEHKFGPLPEDMLTALQAIADTDALDTLGLALLDAPDIEAFRRQLP
PSVS
Download sequence
Identical sequences Q7NNU1
251221.glr0318 gi|37519887|ref|NP_923264.1| NP_923264.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]