SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37519920|ref|NP_923297.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|37519920|ref|NP_923297.1|
Domain Number - Region: 12-57
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.0207
Family Pyruvate oxidase and decarboxylase, middle domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37519920|ref|NP_923297.1|
Sequence length 59
Comment hypothetical protein gsl0351 [Gloeobacter violaceus PCC 7421]
Sequence
MPSVGVSASRCLPMNSRIRWVEEQFLEPEEVREILLKLRQAALPIVLVGGQAVHFWAMH
Download sequence
Identical sequences Q7NNQ9
gi|37519920|ref|NP_923297.1| NP_923297.1.44878 251221.gsl0351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]