SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37519931|ref|NP_923308.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|37519931|ref|NP_923308.1|
Domain Number - Region: 140-199
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0145
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37519931|ref|NP_923308.1|
Sequence length 358
Comment hypothetical protein gll0362 [Gloeobacter violaceus PCC 7421]
Sequence
MRSVLLAVHRFSGLAVGLVLLVIGLTGSAIVFIQPLDRALHPHLYGSTTAKSVSVERVVA
AARAEYAQTPPLAVGFFDHSPPLVFFVPSGGKSVHAFVDPATYRVRGVRIWEQSPLGFLY
QLHTQLLAGEVGKAIVGAIGLLMVAMVLTGLVLWPGWNKWRAGFSLRLGSDGRLAAYDLH
KILGITTAALLGLSAATGAALAFRPAVESVAHTVEGTPAPKPPQSAPNGRPAIGADAAVE
KALPALAGAGLYGVFFPAGPQGTYEVMGRFEGEAPARELIHAYVDQYSGRVLRVEDDRRA
GGADALLHWLAPLHYGTFGGPATQVLYVLVGVAPGALFLSGFWWWLGKLRRTRAVAKT
Download sequence
Identical sequences Q7NNP8
gi|37519931|ref|NP_923308.1| NP_923308.1.44878 251221.gll0362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]