SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520029|ref|NP_923406.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520029|ref|NP_923406.1|
Domain Number 1 Region: 44-118
Classification Level Classification E-value
Superfamily E set domains 0.000000000000573
Family E-set domains of sugar-utilizing enzymes 0.014
Further Details:      
 
Domain Number 2 Region: 201-282
Classification Level Classification E-value
Superfamily E set domains 0.00000000012
Family Other IPT/TIG domains 0.047
Further Details:      
 
Domain Number 3 Region: 121-200
Classification Level Classification E-value
Superfamily E set domains 0.00000000014
Family Other IPT/TIG domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37520029|ref|NP_923406.1|
Sequence length 471
Comment hypothetical protein gll0460 [Gloeobacter violaceus PCC 7421]
Sequence
MEIVMYYLQLFRPVPILSYCALFYTLLVLLGLPELGSRALAAGISGFSPSSGPIGTTVTI
DGSGFKDVSSVQFGGGNVSFTQTSDSTITATINSNAETGKITVKASSGSLTSSNSFTVTI
AKPSISSFSPAGGPPETKVVVKGANFEGVQSFKIGNVYLPFTYDSSSQLTATTKVGNVTG
KITITTSGGSVTSSNTFTSDPPSITSITPLQGSAYPATDITIKGINLSGIGGVAFGKGYA
ERWEYISHNELRTQVPCTASTGKVTIDTFAGKITSYNDFTVPDAGVPSDVPQRIACVKEP
LTPPDGFTAITYWGQAIVDTSKTGEATVEIDYMKLWCTINGTEKLLADDQGSVYGHLYVR
SGWYSIRETEPMPYTYNAQNDSVVLKLSQHPDKIFHWYMNTPRASWSPQDTVSGCRVEGR
MKISGPALVQLGADWWVDAYAPWNGAQVNNREMGYTNWYRQSPDWRVIDLP
Download sequence
Identical sequences Q7NNF1
NP_923406.1.44878 gi|37520029|ref|NP_923406.1| 251221.gll0460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]