SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520069|ref|NP_923446.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520069|ref|NP_923446.1|
Domain Number 1 Region: 625-930
Classification Level Classification E-value
Superfamily DNase I-like 3.84e-31
Family DNase I-like 0.022
Further Details:      
 
Domain Number 2 Region: 938-1017
Classification Level Classification E-value
Superfamily E set domains 0.00000000000967
Family E-set domains of sugar-utilizing enzymes 0.025
Further Details:      
 
Domain Number 3 Region: 246-350
Classification Level Classification E-value
Superfamily CalX-like 0.000000000536
Family CalX-beta domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37520069|ref|NP_923446.1|
Sequence length 1019
Comment hypothetical protein glr0500 [Gloeobacter violaceus PCC 7421]
Sequence
MHLEAARRVRVWSNTRKAQAGAVPFWVVLPRVMRGLLWRDAVIRRQDFPTPARIAAAGLL
AGSLLLGSLSMARAFTQNPATVFINEIHYDNTGTDAGEAVEIAGPAGTDLSGWSIVLYNG
SGGAVYTTTALGGTIADQQNGFGTVAVSYPSNGIQNGSPDGIALVSPGGTVVQFLSYEGS
FAATDGPASGLTSTDIGVAETGSEPLGLSLQLTGSGTVYQDFAWAAPADDSFGQINGSQG
FGGGPLPTLSVAVSPASFSEAAGAAAATGTVTRSGSAEAAVSVNLSSSDGSEAVVPATVT
IAAGASSAAFAVDAVDDAISDGSQAVTITAAAPGFATGTTGLTVTDDEPVSVTPIREIQG
KAQISPKNGQFVSNVPGIVTAKRSNGFYLQDPAPDSDEGTSEAIFVFTSSAPTVAVGDSL
TVSGTVTEFIPGGASTGNLSITEITSPAITVISSGNPLPAPMVIGVGGRVPPTQVIDDDG
LTSFDPAGDGIDFYESFEAMRVQVNGAVATSPTLTFNEGESDENSEIIVLADGGAGAALR
TTRGGIVIRPGDFNPERIFLGDAIARPGQILPKLNVGDSFSGPVVGVLDYSFGNFKLLVT
ETLPGTASAGLTPEQTTLAAGGSQLTIASFNVENLDPGDTERIAGLAAAVTGNLKSPDIL
VLQEVQDNNGPTDDGTVDSTTTLADLAAAIAGVGGPAYNFRFINPVNNQDGGEPGGNIRV
VFLFNPARVSFIDRPAPDGTDLSTTAVGAVDGPSGLELTFSPGRIDPANPAFDDSRKPLV
GEFLFNGRKLFVVGNHFNSKGGDTPLFGAAQPPVLNSEPQRLGQATAVNSFVQSLLALDA
KASVIVLGDLNDFQFSPPLATLQQGGILSNLIDAVSPADAYTFNFQGNSQVLDHILLSGS
LAAGAEIDIVHLDSEFADALSDHDPPLARLDLVLAPLSVTGVSPTSGPVGTQITIAGTGF
VAGGTTVRFRGGVEASAVAVNGDGTQLTVTVPAGARSGRIAVRTGGRAVLTPGRFVVTP
Download sequence
Identical sequences Q7NNB1
NP_923446.1.44878 251221.glr0500 gi|37520069|ref|NP_923446.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]