SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520123|ref|NP_923500.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520123|ref|NP_923500.1|
Domain Number 1 Region: 95-261
Classification Level Classification E-value
Superfamily alpha/beta knot 3.6e-41
Family SpoU-like RNA 2'-O ribose methyltransferase 0.00061
Further Details:      
 
Domain Number 2 Region: 1-99
Classification Level Classification E-value
Superfamily L30e-like 6.83e-23
Family RNA 2'-O ribose methyltransferase substrate binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37520123|ref|NP_923500.1|
Sequence length 265
Comment tRNA/rRNA methyltransferase [Gloeobacter violaceus PCC 7421]
Sequence
MLTSLQNPVIKQLRKLHAAKERQAQGLFLVEGTHPVAAALAGGWELEFVCATEAWVGEHP
AMHTALSGRAGRYETVAPAVIEALADTVHPSGVVAAVRRRADAWRPLLERDVSLLVLGER
LQDPGNVGTLVRSCAAVGADGLVLSADSVDPDHPKVLRASAGLWFRSPPLSVPDLTACVA
DLVRRGVQVLAADAGAGRSLWECDLRRPTAFVLGSEGQGLSEPLRRCLPERVGIPLAPGV
ESLNVAVSGALLLFEAARQRRGSSH
Download sequence
Identical sequences Q7NN60
gi|37520123|ref|NP_923500.1| 251221.gll0554 NP_923500.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]