SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520125|ref|NP_923502.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520125|ref|NP_923502.1|
Domain Number 1 Region: 503-592
Classification Level Classification E-value
Superfamily PKD domain 8.63e-24
Family PKD domain 0.0015
Further Details:      
 
Domain Number 2 Region: 82-213,247-498
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 1.96e-18
Family Soluble quinoprotein glucose dehydrogenase 0.001
Further Details:      
 
Weak hits

Sequence:  gi|37520125|ref|NP_923502.1|
Domain Number - Region: 739-920
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0095
Family Beta-D-xylosidase C-terminal domain-like 0.061
Further Details:      
 
Domain Number - Region: 967-1154
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0142
Family Beta-D-xylosidase C-terminal domain-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37520125|ref|NP_923502.1|
Sequence length 1161
Comment hypothetical protein gll0556 [Gloeobacter violaceus PCC 7421]
Sequence
MCLDAVAPSEFWRYPLSNFGPCAIGFPTVHAVLTCSVREAMNMNVFSLPSVQIRPIHFIG
TLTTLVWLLCLWFGTAAWADPTLPAGFVSETVVTGISKPTTIAWTPDGTKMFIAIKDGHV
RVVDKGVLLGTDFIDISAEVNDYYDRGLLGIAVHPEFPAKPYVYLLYTYDPPGVVSNGTG
ARVSRLLRVSADPNNLNVALPGSAVVLLGKNSTFEHIGDPASNFGPSSCEQAGLFVDDCL
PSDHYFHTIGTVTFGIDGSLYVGNGDGSSLTVDTQKLRVLNLDSFAGKILRINPLTGDGY
ADNPFFDGDPTHNRSKVYNYGLRNPFRFSIHPQTNEPFIADVGWTNWEEINSGRGKNFGW
PCYEGRDGGVSEPQAKYRDSTATKDACSALYAQEASAVQAPLYAYPHNGKGAAVLAGPFY
QGIAYPASYQGAMFIGDYNNDWIKYLAFAADGSASVQDFASDLSPAGGPVQIVQGPDTNL
YFVIFNGSDNSEIRRIRYVAGGNTPPLARVGATPTSGLAPLAVSFSSGGSSDADGGPLLY
SWQFADGTSSTDPNPVHTYTADGTYSATLTVTDAQGSAATATIAISVGNRPPAARITTPA
NGSTYADGQTVYFTGEASDPEEGTLTGDRLQWELYQHHNEHVHFDLLPPTSGTSGSFTPV
VHGEDGDPAYLELCLRAGDASGLQDSDCLNLYPAAAVDGLRLDFASAAGTVVDKDGEGTG
FTSVQPNAAANQYDPARIDLDRAAGTLALTATRGGLAANTLKNGLQAVLDATRPFTVSAR
LRGPFTSLSAAFQQGGVFFGPDQNNHVRLVIVHNGAAGLSLLLQQEQNGKLLNVAEVKNL
DWAGIQTLDLFLQGDPDGGKIAASYRINSDATAPTAMPGVFQPTTPAPFFADDASARAGI
LAFTGSGPDTVFRFESFAIEHPLPGQLNLDFASAAVGTVVDKDGEGTGFTSVQPNAAANQ
YDPARINLDRAAGTLVLTATQGGPGPNTLKNGLQAALDATRPFTVSARLQGPPTNLTTAY
QQGGIFVGRDQDNYVKLVVVNSASGTGGLGLQFYQEQNGVRTSVGGGQASQIKGLDWAGI
RTLDLFLQGDPATGKITASYRINSDTAAPIPFAQVFQPTNPGVFFADAATARAGILALTS
NAPDVTVVFESFALQSAAVGP
Download sequence
Identical sequences Q7NN58
gi|37520125|ref|NP_923502.1| 251221.gll0556 NP_923502.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]