SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520161|ref|NP_923538.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520161|ref|NP_923538.1|
Domain Number 1 Region: 52-378
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.35e-66
Family Integrin alpha N-terminal domain 0.0048
Further Details:      
 
Domain Number 2 Region: 387-468
Classification Level Classification E-value
Superfamily E set domains 0.00000000000293
Family E-set domains of sugar-utilizing enzymes 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37520161|ref|NP_923538.1|
Sequence length 471
Comment hypothetical protein glr0592 [Gloeobacter violaceus PCC 7421]
Sequence
MGCVRVGCRWSRGVRWWGLGLAAALGVWASPVGAQVEFLPAQSVPIGDEPESVASGDMDG
DGDLDLVTANPNSEGVSVLLNRGDGSFGPAWSFAAGDIPYSVALGDLDGDGDLDVATDSF
FYVLVLLNNGDGSLAPAQSFAAGYPLSSVALGDLDGDGDLDIVTTAPGFYGLNNADVPVL
LNNGDGSFAPAQTFTAGDIPYSVALGDLDGDGDLDIAVGGTFLDTVSVLLNSGDGSFGLA
QTFAAGDGPTSLALGDLDGDGDLDVVTANVLDNDVSVLLNSGDGSFAPAQSFAAGDGPES
VALGDLDGDGDLDVATANSDSNNLSVLLNSGTGTFDPAQSFAVGRSPQSAALGDLDGDGD
LDIATANSGSNNVSVLQNITQDASSLTIAALSPGGGPVGTEVIITGTGFTGTTAVTFRLG
FPQRRIPAEFTVLSDTEIRAVVPAGAKTGRITVETPEGQAVSPTVFLVVGP
Download sequence
Identical sequences Q7NN22
NP_923538.1.44878 251221.glr0592 gi|37520161|ref|NP_923538.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]