SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520205|ref|NP_923582.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520205|ref|NP_923582.1|
Domain Number 1 Region: 534-938
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.56e-146
Family DNA polymerase I 0.0000000044
Further Details:      
 
Domain Number 2 Region: 352-531
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.36e-47
Family DnaQ-like 3'-5' exonuclease 0.0000562
Further Details:      
 
Domain Number 3 Region: 4-184
Classification Level Classification E-value
Superfamily PIN domain-like 2.47e-43
Family 5' to 3' exonuclease catalytic domain 0.0000248
Further Details:      
 
Domain Number 4 Region: 185-299
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 1.47e-30
Family 5' to 3' exonuclease, C-terminal subdomain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37520205|ref|NP_923582.1|
Sequence length 938
Comment DNA polymerase I [Gloeobacter violaceus PCC 7421]
Sequence
MPDSSAPVLLLVDGHSLAYRAYFAYVRGGETGLRTSGGTPTSVSFGFLKLLLDAIERDRP
SMVAVTFDTRMPTFRHEVDATYKSGRAETPDEFIDDLQNLREILTALDLPQFELPGYEAD
DLIGTLAVHGAGQGYDVKILSGDQDLFQLITDEGAPGGSIRVLHQNTRTGTEEFGPAQVK
EKLGIAPRQVVDYKALCGDSSDRIPGVRGIGAKSAVKLLEEYGSLAQLIEAVDTIPGALG
KKLKEGVEDARHSYWMATIETNVPLVVDFEACRLVGFDAERVAPLLEKLEFRSFLRQLQR
LQRSFGGTPSARPTALNEDADNPLAGIGTASEDELWFDFAPSVPMDLEVRVVQTAEDFQA
FLDALLAQDGLVAWDTETNNLDPRHARLVGIGCAWEPGVAYYLPLAHQQGSNLETDAVVA
ALTPYWQDRERPKVLQNAKYDWLVLRNYGVALAGIAFDPMLASYVLDPEGKHNLMTLAQN
HLQITMGSYEALVPKGQTIDAVEIAAVSRYCGEDAAVTLRLVPVLQAKLDEDPRLAGIFK
EIEVPLEPVLARMEERGIRIDKAYLGELAQELDRDLESLEQEAYTLAGSKFNLGSPKQLS
DLLFNKLGLSAKKSRKTSLGYSTDAAVLEKLRDDHPIVEAILSYRTLAKLKSTYVDALPL
LVDPRTDRVHTDFNQTVTTTGRLSSSNPNLQNIPVRTSFSRRIRRAFVPEPGWLLVAADY
SQIELRILAHLTQEPVLLEAFQTGGDVHTLTARLLLGREEVTSEERRLAKIINYGVVYGM
GARRFARETGVSATEAEDFIKAFYRRYPAVFGFMEQTRRMAVEQGYVETLLGRRRYFRGL
GQLNQRDREGALRAAFNAPIQGTAADIIKIAMVRLEQTLAGRRTRLLLQVHDELVFEMPP
EERPEVEPLIRSGMENALDLLVPLKVELNAGPNWLEAK
Download sequence
Identical sequences Q7NMX9
NP_923582.1.44878 251221.gvip065 gi|37520205|ref|NP_923582.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]