SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520211|ref|NP_923588.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520211|ref|NP_923588.1|
Domain Number 1 Region: 72-400
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 7.94e-64
Family Integrin alpha N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 407-484
Classification Level Classification E-value
Superfamily E set domains 4.85e-18
Family E-set domains of sugar-utilizing enzymes 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37520211|ref|NP_923588.1|
Sequence length 486
Comment hypothetical protein gll0642 [Gloeobacter violaceus PCC 7421]
Sequence
MGLFLRLGSQQSFHREFTMLLKIFSKLLPTLRSREVRLVGFGLAATVALSAAPVQAQVEF
APAQTFSVETTPRALAIGDINGDGDLDLVTANIGNNTLSALLGGGDGTFAAARNFAAAGG
TCAVATGDFDGDGDLDLAAANRFADNISVLSGNGNGTFGAARNYLVDGSFPTGVAAGDLD
GDGDLDLVSANRYSANISLFKNNGNGTFGIPRSLPLPAGPAEVIFADIDEDGDPDLVVAN
IFSASVSVLLNDGKGTFAAARNFAAAGGTSGVVVGDFNGDGDLDMAATSRIADKVSVMLG
DGTGSFGPAQNFVVGDYPVAIAMGDLDKDGDLDLITSNRRPASNVEVLINNGSANFSATQ
IFPAGGEGATYIGVGDLDEDGDLDVAVANGTASNVGVLLNTGDGTAAPSIESIAPRSGSV
GTEVTITGTGFTGATAVTFGGVSAEFTVVSGTQITAIVPAGAASGPIAVTTPAGTNTSTR
RFRITS
Download sequence
Identical sequences Q7NMX3
NP_923588.1.44878 251221.gll0642 gi|37520211|ref|NP_923588.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]