SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520271|ref|NP_923648.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520271|ref|NP_923648.1|
Domain Number 1 Region: 4-221
Classification Level Classification E-value
Superfamily PLP-binding barrel 7.59e-63
Family "Hypothetical" protein ybl036c 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37520271|ref|NP_923648.1|
Sequence length 232
Comment hypothetical protein glr0702 [Gloeobacter violaceus PCC 7421]
Sequence
MGVAERIEWLRGQLPAAVRLVAVTKQVPVERIREAYDCGLRDFGESRIQEVQQKIPQLTD
LQGVSWHLIGSLQRNKARPALEVFDWIHSVDSLPLAERLASLMDSVGRRPRLLLQVKLAA
DPTKSGWSQAELEAALPRLAALPQLDIRGLTAIAPLGLGEQGNRTLFGQVAALARDLGRR
AGEAGWQHIRMEELSMGMSGDYPQAIAAGATMVRLGQVLFGSRLPLRRNGDE
Download sequence
Identical sequences Q7NMR3
251221.glr0702 NP_923648.1.44878 gi|37520271|ref|NP_923648.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]