SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520283|ref|NP_923660.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520283|ref|NP_923660.1|
Domain Number 1 Region: 38-365
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.53e-62
Family Integrin alpha N-terminal domain 0.0081
Further Details:      
 
Domain Number 2 Region: 371-448
Classification Level Classification E-value
Superfamily E set domains 3.62e-17
Family E-set domains of sugar-utilizing enzymes 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37520283|ref|NP_923660.1|
Sequence length 463
Comment hypothetical protein gll0714 [Gloeobacter violaceus PCC 7421]
Sequence
MRNLWWMGLGLAASLVIQAPALRAQVNFAPARNIPVGLYPGTALTGDLDGDGDLDVVAAT
QDSDDVSILINNGDATFAPARFVPVGDSPETIAVGDLDGDGDLDIAAANRLSDDLTILKN
NGSAIFTASQVVSLREDPFFMVTGDFDDDGDLDLAIANRFDDSVTILPNNGSANFTVGSE
FGVGDGPFGLTRGDFDGDGDLDLATSNRFSNDVSVLFNNGAASFTLNQTIATGEGARALT
PADLDGDGDLDLAVANRFATNLSVLKNAGNGTFAVSQTVTVDVNPRAVVAGDLDGDGDLD
VATANQESGTVSVLLNNGNAVLSPAVNFAVGSEPRSITAGDLDGDGDLELLTANSDSDNV
SVLINTEVALPTIAGFSPTSGPVGTLVTITGTNFTGASAVTFGGAGARSFAVLSATQIQV
RVPRGATTGKIVVTTPAGNATSAGNFTVTPRPGRQPVRPAGRR
Download sequence
Identical sequences Q7NMQ1
251221.gll0714 NP_923660.1.44878 gi|37520283|ref|NP_923660.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]