SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520375|ref|NP_923752.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520375|ref|NP_923752.1|
Domain Number 1 Region: 775-997
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 4.05e-43
Family Multidrug efflux transporter AcrB transmembrane domain 0.00011
Further Details:      
 
Domain Number 2 Region: 294-489
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.7e-42
Family Multidrug efflux transporter AcrB transmembrane domain 0.000033
Further Details:      
 
Domain Number 3 Region: 41-133
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.23e-23
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.002
Further Details:      
 
Domain Number 4 Region: 546-633
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000000000000214
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.01
Further Details:      
 
Domain Number 5 Region: 183-265
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000000471
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0091
Further Details:      
 
Domain Number 6 Region: 139-182,268-311
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000000000199
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0069
Further Details:      
 
Domain Number 7 Region: 686-774
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000484
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37520375|ref|NP_923752.1|
Sequence length 1022
Comment AcrB/AcrD/AcrF family protein [Gloeobacter violaceus PCC 7421]
Sequence
MNNLSAWSIRHPIVIAVLFIALVIAGVVGFVQLPINENPNVDVPTVSVNITQSGAAPPEL
ESQVTRKIEDALAGIENVEHLRSTIKDGISATTVEFVLGTDTDRAVNDVRDAVTKIRQEL
PQDIDEPVIARVDFVGGALMIYAVGSPTRSTEQLSWFVDHDVSRALLTVEGVSRVQRFGG
VSREVRIDLDPNRLFALGITAEEVNRQVRALNRDLPGGRGELGGREQAIRTLGSAATVEN
LRATQIALSGGRRVALADLGSVSDGASEARQLARLDGKPVVGFSVIRSTGSSEVAIEKGV
EAQIAQLEKRFADVHFDLVNTSVRYVHENYDASIEALWLGAALAVVVVYLFLRDGRATLI
AGVAMPLSTIPTFAIMKLLGYSLNSLSLLALALVVGVLVDDAIVEIENIDRHIKMGKPPF
QAALDAADEIGLAVVATTMTIVAVFVPVGFMGGVPGQFFGQFGFTVVAAVLFSLFVARMV
TPLMAAYWLAAKPAPVRLPWYTRTYRTVLAWALSNRAATIAAAVAFFVLSLLLAPLIPSG
FLANTDRGQSIVQLELPPGSTLAQTDAVARGLSAQLQKWPEIKNVFVSMGDQGEVRLATL
FINLKPREERTIAQQDFEKAIQPVLAAVPGARLGFSVGFRGGKEVSIILTGEDTAELART
AERLSTQMQALSGLANVSNTASLSRPELLIRPRFERAADLGVSVERIGATAKIATLGDID
ANLAKFNLEDRQIPIRVQIAPRHRTDLEVIRNLRVTADDGRAIPLETVAELAVGSGAAQI
DRYDRARQISVEANLNGVQLGPALEQIYALPAMGDLPESIRLVRSGDVDLQDQVSERFGT
ALLLGVLLIYGVLVLLFGDFFHPLTIMAALPLSIGGALAGLLVTGKPLVLPALIGILMLM
GIVTKNSILLVEYATVLIEKARLPRREALMEAGIDRLQPILMTTIAMIAGMMPIALGIGA
GSEFRSPMAVAVVGGLLSSTLLTLVVIPVLFTYVDDFKNRLARLGRRRTIETAQAVQTPA
QQ
Download sequence
Identical sequences Q7NMG0
NP_923752.1.44878 251221.glr0806 gi|37520375|ref|NP_923752.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]