SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520399|ref|NP_923776.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520399|ref|NP_923776.1|
Domain Number 1 Region: 20-141
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 3.14e-31
Family N-utilization substance G protein NusG, N-terminal domain 0.00018
Further Details:      
 
Domain Number 2 Region: 132-204
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00000000000000217
Family N-utilization substance G protein NusG, C-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37520399|ref|NP_923776.1|
Sequence length 205
Comment transcription antitermination protein NusG [Gloeobacter violaceus PCC 7421]
Sequence
MVIGTDFLMDSARKPEQPEPHWYFVQVASGCEKKVKTNLEQRIQTMEMSERILKVEIPER
QAVRIRQEGSRTASAEKIFPGYVLINMVMDDESWQVVKNTPNVINFVGTEERRRYGRGRG
HVTPRPLGSAEVNRIFRAAEQEEPVIKVDLEPGHKIEVTAGPFQDFNGEVVEVNPERGTL
KALISIFGRDTPVELGFNQVRRLDE
Download sequence
Identical sequences Q7NMD6
NP_923776.1.44878 gi|37520399|ref|NP_923776.1| 251221.gvip098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]