SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520457|ref|NP_923834.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520457|ref|NP_923834.1|
Domain Number 1 Region: 118-284
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 9.03e-60
Family NadC C-terminal domain-like 0.00000804
Further Details:      
 
Domain Number 2 Region: 8-117
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 9.42e-28
Family NadC N-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37520457|ref|NP_923834.1|
Sequence length 296
Comment nicotinate-nucleotide pyrophosphorylase [Gloeobacter violaceus PCC 7421]
Sequence
MLTNRYALPHPLLLDPLLSSWLAEDWGRGDRTSEALFAEESPDGHGKILLKEAGVVAGLP
LVERLFAIVDPAVRFAPMCEEGTAAEARTVIAVVEGPVRSLLMGERVALNLLQRLSGIAT
ITRRYVERLAGHHARLVDTRKTTPGLRLIEKYAVRVGGALNHRFGLDDAAMIKDNHIEAA
GGIRPAVERLRGRIPFLMPIEVETESLEQVQEALGCGVQVIMLDNMPVERMREAVQLIAG
RVLTEASGNITLDTLGDVAATGVDYISTSATITRAPWLDISLDLRRVPTTDTLPLD
Download sequence
Identical sequences Q7NM79
NP_923834.1.44878 251221.gvip119 gi|37520457|ref|NP_923834.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]