SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520461|ref|NP_923838.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520461|ref|NP_923838.1|
Domain Number 1 Region: 50-308
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 5.76e-47
Family Integrin alpha N-terminal domain 0.0033
Further Details:      
 
Domain Number 2 Region: 270-420
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.92e-24
Family Integrin alpha N-terminal domain 0.013
Further Details:      
 
Domain Number 3 Region: 405-485
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000327
Family E-set domains of sugar-utilizing enzymes 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37520461|ref|NP_923838.1|
Sequence length 487
Comment hypothetical protein glr0892 [Gloeobacter violaceus PCC 7421]
Sequence
MCMETTLQRLFFAGSAVGSCATRTGLIGLGLAVSLSLGTLPVRAQVDFAPAQNFYAGGNP
NSVAVGDFDGDGDLDLALANGSYGDSGPVSVLLNDGQGVFSAPSTFGAGDLPVSVVAGDL
DGDTDLDLAVANGGFDSEAVSVLKNNGDGTFGPPQAFQISGLGFPYAVTTGDLDGDGDLD
LVAVSTYDLGAVSVLLNRGNGSFVETGFDYGGYGLNAVTVGDLDGDGDLDVAITSSGFGD
NGYVVVFLNNGKGELSFISSINVGGNPLSIQAADFNGDGDTDLVSADASFSALSVLLGNG
NGTFASPQSISIKIRPYSVTVGDFDGDGDLDLATANYGSDNISVLLNGGGGDFAPALDFA
ADKGTRSINVGDFDGDGNLDLVAANFQAANVSVLLNTTGLDAALSIDTFTPRRGPAGTEV
TISGSGFAEATAVLFKGNTTRAVPADFTVVSDTEIMAIVPTGAVSGRILVKNPTGTATSR
GRFEVTP
Download sequence
Identical sequences Q7NM76
gi|37520461|ref|NP_923838.1| 251221.glr0892 NP_923838.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]