SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520464|ref|NP_923841.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520464|ref|NP_923841.1|
Domain Number 1 Region: 108-439
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.57e-59
Family Integrin alpha N-terminal domain 0.0074
Further Details:      
 
Domain Number 2 Region: 449-524
Classification Level Classification E-value
Superfamily E set domains 0.0000000000113
Family E-set domains of sugar-utilizing enzymes 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37520464|ref|NP_923841.1|
Sequence length 526
Comment hypothetical protein glr0895 [Gloeobacter violaceus PCC 7421]
Sequence
MRYCRIGAAGLVDAPIWSNGDCFDSVKSHLRLCRTVGCSDCWLYHMTHSAFQEIFMNFAA
CLLSGFRKPAAVEMGLLPPWLIGLGLAASVALPALPVQAQVAFSDAQSFSVGISPYAVAC
GDLDGDSDLDLFTANRDSNNVSVLLNNGDGTFAERRDFAVGYTPLSVASGDFDGDGDLDL
VSANVATNEVSMLLGDGSGNFATAVKFRTDSGPSSVEVGDLDGDGDLDLATANVYSNNIS
VLLNNGNATFAAFRSFAAAQRTKAVAAADLDGDGDLDLAAANQDANTVSVLLGNGDGTFA
GASDFAVGSAPVSLIEGDFDDDGDLDLVAANDLSDDVSVLINRGDGSFDAPSNAFIRNGS
YAVTVGDIDRDGDLDLAAANNVYVSTLLNNGDGTFASALNFPAGETAPFGVSVGDLDGDG
DLDLAAAVFNASTVSVLLNTTATGIPVAIEVFSPRFGPVGTQVTLTGSGLAAATAVTFKD
GVATSFTVVSDNEVRVTVPVGALSGRVKVTTTAGSAASHNRFLVTP
Download sequence
Identical sequences Q7NM73
NP_923841.1.44878 gi|37520464|ref|NP_923841.1| 251221.glr0895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]