SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520527|ref|NP_923904.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520527|ref|NP_923904.1|
Domain Number 1 Region: 83-348
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.27e-60
Family BC ATP-binding domain-like 0.00000903
Further Details:      
 
Domain Number 2 Region: 1-110
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.29e-45
Family BC N-terminal domain-like 0.0000285
Further Details:      
 
Domain Number 3 Region: 330-439
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 6.28e-35
Family BC C-terminal domain-like 0.0002
Further Details:      
 
Domain Number 4 Region: 624-750
Classification Level Classification E-value
Superfamily Cyclophilin-like 7.59e-33
Family PH0987 C-terminal domain-like 0.017
Further Details:      
 
Domain Number 5 Region: 912-1041
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.97e-26
Family PH0987 C-terminal domain-like 0.0011
Further Details:      
 
Domain Number 6 Region: 797-888
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 3.66e-19
Family PH0987 N-terminal domain-like 0.0043
Further Details:      
 
Domain Number 7 Region: 1118-1194
Classification Level Classification E-value
Superfamily Single hybrid motif 4.97e-18
Family Biotinyl/lipoyl-carrier proteins and domains 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37520527|ref|NP_923904.1|
Sequence length 1202
Comment urea amidolyase [Gloeobacter violaceus PCC 7421]
Sequence
MFDKVLIANRGEIACRILRTLDRLGIASVAVYSEADAYAPHVRGAGEAVLIGPAPAAQSY
LRYERILEAAVATGAQAIHPGYGFLSENAEFAEACERENIVFIGPTPLQMGRFGRKHTAR
ALAAENGVPLLPGTGLLIDLAEAHRQAAAIGYPVMLKSTAGGGGIGLALCRGEAKLTESF
QAVQRLSENNFRDGGVYLEKYVERARHLEVQIFGDGEGRVIALGERDCSIQRRNQKLLEE
TPAPGICETLRERLCEAAVCLGRAVGYRSAGTVEFIYDAEAADFYFLEVNTRLQVEHGVT
EAVAGIDLVEWMVRLAAGERDFLEQYRHRPRGHAVEVRLYAEDAGRNFQPSTGTLTEAVF
AAVRCDGWVERGTEVTPYYDPLLAKLIVRGESRPEAIARLQAALADTRIAGVETNLDYLR
QILADADFLAGNLSTRFSQTFHYAPLTVEVLEPGTYSTIQDYPGRTGYWDIGVPPSGPMD
PLAFRLANRLVGNPPETAGLECTALGPTLRFHTDAVICLCGAAMDARIDSKPVSYWCAVP
VAAGSTLRLGAVTGPGYRTYLAVRGGFDVPEYLDSKATFTLGQFGGHCGRTLRTGDVLRL
VRHDLADLPLPLAPALIPEYRSDWEIGVLYGPHGAPDFFTDRDIETFFATAWEVHYNSAR
TGVRLIGPKPLWARSDGGEAGLHPSNIHDNAYAVGTVDFTGDMPVILGPDGPSLGGFVCP
ATVARAELWKIGQLKPGDTVRFRRLGFAEALRREQAQDFTIDRLSLPKPAAPSLAEAGDP
AVLHTIAATAEQIAVVYRQSGDKYLLIEYGPPVLDLNLRFRVHALMEWLQANALPGMLEL
TPGIRSLQVHFDGRILPRERLLEVLTAAESQLPPIEAMEVPTRILHLPLSWEDESTLLAI
RKYMQSVRKDAPWCPSNIEFIRRINGLESIDEVKRIVFEASYLVLGLGDVYLGAPVATPI
DPRHRLVTTKYNPARTWTPENAVGIGGAYLCIYGMEGPGGYQFVGRTVQVWNRYRQTADF
TRPWLLRFFDQIRFYPVSGPELLRLREDFRHGRAKLEVSEAIFSLKQYNDFLAEIAPEAA
AFKAQQQTAFAEERERWREAGEFAAVAEDPAIAPSAAEEYALPAGACAVSAQLSANVWQI
AVQPGEPVAAGDPLVILESMKMEVVLTAPISGTVLAVLCAEGCLVAAGQTLVVVQPSESA
PP
Download sequence
Identical sequences Q7NM11
gi|37520527|ref|NP_923904.1| 251221.gll0958 NP_923904.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]