SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520602|ref|NP_923979.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520602|ref|NP_923979.1|
Domain Number 1 Region: 334-633
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 6.54e-83
Family DNA repair protein MutS, domain III 0.000001
Further Details:      
 
Domain Number 2 Region: 635-869
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.77e-59
Family ABC transporter ATPase domain-like 0.000000945
Further Details:      
 
Domain Number 3 Region: 170-234,264-346
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 1.7e-42
Family DNA repair protein MutS, domain II 0.0002
Further Details:      
 
Domain Number 4 Region: 15-111,150-168
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 3.79e-35
Family DNA repair protein MutS, domain I 0.0000717
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37520602|ref|NP_923979.1|
Sequence length 890
Comment DNA mismatch repair protein MutS [Gloeobacter violaceus PCC 7421]
Sequence
MADPATQLSQWDFRRFARSDLTPMLQQYVEVKAQHPHCLLLYRMGDFYETFLADAEIVSR
ELEIVLTGRQAGDKIGRIPMAGIPHHALERYCAQLIEKGYAVVICDQVESPEQAKERARQ
AKVARRSKSDGDAPLLPLLLEDGEQIDWEGAESVLVRRAVTRVLTPGTVLEDQLLVGRRN
NYLAALVQAGECWGLAFADISTGEFQVTQLESAEALVQELLRLQPAEVLLSGDAPDPLVL
LRPGEASSERPECLPSQFCYTLRPRRYFELDEARRLLMETFGVRSLEGFGCENLPLAVRA
AGGLVQHLLETQRGVSIPLEGIRTYTLSQYLILDHQTRRNLELTQTVRDGAQYGSLLWAL
DRTRTVMGGRALRRWLLQPLLDTRAIGRRQDSVAELYDEGLLRERLQRILESVYDLERLA
GRCGSGTANARDLVALGESLLKLPALAEAVAASTSPYLKALQSIPVELERLGEKLRRTLV
DTPPLILTEGGLIRAGVHPELEGMRGQLIEDRDWLVDLEARERARTGIQTLKVGFNKAFG
YYLSISRGKAEKAPPEYLRKQTLTNEERYITPELKERETRILNAQQQTNQLEYDIFNILR
QEAGRHVSALRQVARRVAALDALAGLAEVAVYHDYCRPVLGEGREVHIEAGRHPVIEQAI
PAGFFVPNDARMGAEAEPDLIILTGPNMSGKSSFIRQVALIQLLAQVGAFVPARGAVLGV
ADRIFTRVGAVDDLATGQSTFMVEMTETANILNHATPRSLVLLDEIGRGTATFDGLAIAW
AVAEYLASHIRCRTIFATHYHELNELASVVSGVANYQVTVQELADRIVFLHRVTPGGADR
SYGIEVGRLAGLPPSVVARARTVLAQVEQHSQIAVGLRDSNGSASESAAG
Download sequence
Identical sequences Q7NLT8
251221.gvip140 NP_923979.1.44878 gi|37520602|ref|NP_923979.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]