SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520614|ref|NP_923991.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520614|ref|NP_923991.1|
Domain Number 1 Region: 9-344
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.45e-83
Family Deoxyhypusine synthase, DHS 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37520614|ref|NP_923991.1|
Sequence length 386
Comment deoxyhypusine synthase-like protein [Gloeobacter violaceus PCC 7421]
Sequence
MAKHRFLAGKKIDPQPIGAGISVSALIDNTFLAYNAGRLREAARLLVERMLRPGVTVGVT
LSGALTPTGLGMAAIIPLMEAGFIDWIISTGANLYHDTHHGIGLDLRRGRADISDVVLRE
EGVVRIYDIFFDYDVLLSTDRFFREIFKAPEFQAAMGTAEFHYLAGKYIAERERQLGLEN
KSLLAAAYRLGVPIYTSSPGDSSIGMNIAAMALDGKGPRLDVSLDVNETAAIVLDAKRSG
GESGVWILGGGSPKNFMLQTEPQIQEVLGIQEKGHDYFLQVTDARPDTGGLSGATPSEAV
SWGKVDPDRLPDTVVCYVDSTIALPLLTAYALDNAESRPLKRLYDRRGEVMAKLKAEYEA
AQAAGGRDHNVGEPAPEHISSQAAGR
Download sequence
Identical sequences Q7NLS6
NP_923991.1.44878 gi|37520614|ref|NP_923991.1| 251221.glr1045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]