SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520785|ref|NP_924162.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520785|ref|NP_924162.1|
Domain Number 1 Region: 112-274
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 9.81e-39
Family Pentapeptide repeats 0.0001
Further Details:      
 
Weak hits

Sequence:  gi|37520785|ref|NP_924162.1|
Domain Number - Region: 31-86
Classification Level Classification E-value
Superfamily ARM repeat 0.000633
Family Leucine-rich repeat variant 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37520785|ref|NP_924162.1|
Sequence length 287
Comment hypothetical protein gll1216 [Gloeobacter violaceus PCC 7421]
Sequence
MTSMDVPNRDPVLGGKAAPPDAPALGGFAGLRLRLLQSTSPEERRAALRKAPDWGEKGLK
LLLVVLGQDADPHVRQEAWELLASRMESAPWLRNPSQSLPRRDIGGRRGLIRCYERGENL
ACADLRAENLCRMNLSFAVLPFADLSGADLSRSVNLKRADLRGARLVGADLRGAFLHGAN
LSGSRLEAADLMKVALAGANLSGADLSRANLRAAHLEGADLRRTNLGEADLAGAFLRGAR
LEGADLRRARLEGADLECAATEGTCWEGADLGGVAWAALSRVKPIDL
Download sequence
Identical sequences Q7NLB0
gi|37520785|ref|NP_924162.1| 251221.gll1216 NP_924162.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]