SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520803|ref|NP_924180.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520803|ref|NP_924180.1|
Domain Number 1 Region: 244-495
Classification Level Classification E-value
Superfamily HemD-like 1.44e-66
Family HemD-like 0.012
Further Details:      
 
Domain Number 2 Region: 1-247
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 1.3e-65
Family Tetrapyrrole methylase 0.00000689
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37520803|ref|NP_924180.1|
Sequence length 508
Comment uroporphyrinogen III synthase/methyltransferase [Gloeobacter violaceus PCC 7421]
Sequence
MPGTVYLVGAGPAGAEYLTVRGRELLEQAEVVLYDDLADPHLLKLASAAQLIDVGKRAGR
PGADQGEIGRLLVTHCQAGRRVVRLKAGDPLVFGRAAAELGALVAAGCNFEIVPGVSSAL
AACAFAGIPLTDRALGRHFCVMSGHDIGTLPWQHLAHIDTLVILMGTRHLEAIAEQLMDY
GRPAAMPVAVIFWAGRSEQRTVVGTLEDIASRVAPSGEPAVIVVGPVVRRRECFDWFDRR
ALFGKHILVTRAADQAGGFSAQLEALGASVLEMPALVVTAPTSWEPLDRAIAQLAGYRWL
LLTSANGVEAFFARLTHHRRDLRALGGVRVAAVGPKTAQAARTHGLICDFVPGQYVSDGL
LTDFPDIAGIYGERVLFVRVESGGRETITEQFRRWGALVDEVAGYATGCPDSAEPGCVAA
LRAGRIDCATFASAKTVRHFARLLQGEELESLLRKVRIASIGPQTSAACRETLGRVDVEA
EVFTLDGLAQAIVADLGTGRATGPTDEQ
Download sequence
Identical sequences Q7NL92
NP_924180.1.44878 gi|37520803|ref|NP_924180.1| 251221.gvip169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]