SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520821|ref|NP_924198.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520821|ref|NP_924198.1|
Domain Number 1 Region: 109-305
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.09e-59
Family BC ATP-binding domain-like 0.0013
Further Details:      
 
Domain Number 2 Region: 8-105
Classification Level Classification E-value
Superfamily PreATP-grasp domain 6.19e-23
Family BC N-terminal domain-like 0.0045
Further Details:      
 
Domain Number 3 Region: 311-380
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 0.00000000000000259
Family BC C-terminal domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37520821|ref|NP_924198.1|
Sequence length 381
Comment phosphoribosylaminoimidazole carboxylase ATPase-subunit [Gloeobacter violaceus PCC 7421]
Sequence
MRPAAGRTGLPTVGIVGGGQLGRMMALAGHALGLRLVVLDPDPASPASQVVPVSLEGAFD
DIESLRSLARITDIVTFENEWVEPLLVAQLEADGCRVWPASRTLARIQDKLHQRTHLAAA
GLPVPRFAAAPSLEAVRAWGGSRPLVLKTRLQGYDGHGVRIVENPAHLEDAWEALAGQPL
MVEAFVTFERELAVMVARSSTGEVRSYPVVETRQRRHVCHTVIAPAPVDEVIRERAGAVA
RAAVEAVEGVGIFGVELFVDARGEVSINELAPRPHNSGHYTLDACTTSQFEQHLRAVLGW
PLADPSMHSPAAVMVNILAEGDAPEAEPDLAAALAFAGVKVHWYGKRGARPGRKLGHITA
VARDPAVAYERALAAREALGI
Download sequence
Identical sequences Q7NL74
251221.gvip177 gi|37520821|ref|NP_924198.1| NP_924198.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]