SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520866|ref|NP_924243.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520866|ref|NP_924243.1|
Domain Number 1 Region: 779-1005
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.22e-48
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000575
Further Details:      
 
Domain Number 2 Region: 293-494
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.83e-46
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000435
Further Details:      
 
Domain Number 3 Region: 42-135
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 9.68e-22
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0027
Further Details:      
 
Domain Number 4 Region: 145-185,271-321
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000000000000118
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0074
Further Details:      
 
Domain Number 5 Region: 692-781
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000000523
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0068
Further Details:      
 
Domain Number 6 Region: 550-640
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000000000167
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.01
Further Details:      
 
Domain Number 7 Region: 186-268
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000667
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37520866|ref|NP_924243.1|
Sequence length 1043
Comment AcrB/AcrD/AcrF family protein [Gloeobacter violaceus PCC 7421]
Sequence
MTWNLSAWSIRNPVPTIALFLLLTAAGVAAFVQLPIAIDPDVQVPKVSVTVTQLGAAPPE
LETQVTRKIEDAVAGIGNIRHITSQIKDGSSSTEIEFLLGTNFDRAVNDVRDAVAKIRSS
LPQSIDQPVIRRVEASRDAETLVEYEVLSASRSVKELSWIADNDVTRAMLAVPGVARVWR
SGGVTREIRVQLDPNRLQALGITALDVDAQIRSLNTNLPGGRGEVGTTEQAIRTLGSAST
VEQLRTTQISLGDGRHARLDTLGRITDGESDPDNLAFLNRVPVVYLGAIRSSGSNLVAVE
EAIDAKMRELARSLPAGVEIRKSWTNATFVRESYSASVEALLLGASLAVVVIWLFLRDGR
ATFIAGLAIPLSVIPTFAVMKLAGFTLNNMTLLALALVVGILVDDAIVEIENIIRHTAMG
KSPFQAALDAADEIGLAVVATTMTIVAVFLPVAFMEGIQGQYFRQFGWSVAAAVLFSLLV
ARMLTPLMAAYWMKPLPHTEQKSFLVRAYDYLLIRALQYRNLTVVLAAGVFALSLWLWPQ
VPTSLVNAADDGEIDLYVLMPPGTPIEQTRQSALQMSALMEAHPAVDRVFSGVGTFGDKK
NQNLFFIYLKPKEQRRLNEKQVEAELRSKLEQVPGVRLSFAGSSFTGGKELQIVLQSDDS
IALERSGSLLVDQMRSVPGLTDVNLASELARPELRVVPNLARAADQGVSVEAIARTALVA
TLGDNPTSLAKFNLPGRQINIRVLLDPRFRQDLQAIENLQLTNGSGQLVPLKAVADIRLN
TGISQIERYDRSRKVTVEANLAPGSELGPALARVHQLPALRNLPAGVREKATGDAEVQKD
VFNGFGGAIAVAVLLVYAVLVLLFGGFLQPLTIMISLPLALGGALVGLLLMGKSMGMYAL
IGIVMLMGLVTKNAILLVEYCLMAMKGGRSRLEAIMSAGETRLRPILMTTVAMIAGMLPI
ALSLGAGAETRSPMAIAVVGGLVTSTLLTLVVVPVVFTYIDDLEQWLSIHLDRTSQQDRR
QAIQADNQPDLPVIARSLPTQQE
Download sequence
Identical sequences Q7NL29
NP_924243.1.44878 251221.gll1297 gi|37520866|ref|NP_924243.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]