SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520875|ref|NP_924252.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520875|ref|NP_924252.1|
Domain Number 1 Region: 179-618
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.72e-119
Family Amylase, catalytic domain 0.0000000031
Further Details:      
 
Domain Number 2 Region: 625-730
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.88e-34
Family alpha-Amylases, C-terminal beta-sheet domain 0.00031
Further Details:      
 
Domain Number 3 Region: 15-112
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000105
Family E-set domains of sugar-utilizing enzymes 0.011
Further Details:      
 
Domain Number 4 Region: 136-196
Classification Level Classification E-value
Superfamily E set domains 0.0000000154
Family E-set domains of sugar-utilizing enzymes 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37520875|ref|NP_924252.1|
Sequence length 733
Comment glycogen branching enzyme [Gloeobacter violaceus PCC 7421]
Sequence
MNPTVELRDIEALVTNLHADPFAILGPHRAEDGGAWVVRTYQPGASRVVLLGESGELAME
NRRHPDLFECAVPTAPGAYRLRVEDAWGERLIEDAYRFRGSLLSDLDGHLFAEGNHHRIY
EKLGAHPAVFEGVAGVYFAVWAPSARNVSVLGDFNRWDGRFHQMRRVERSTGIWELFIPE
LGEGTVYKFEIKNGFGHIYEKSDPYAFQQELRPKSGSVVADLDRYSWNDGEWLKRRALSN
PLKQPLAIYEVHLGSWMRVPEEGDRFLSYTELADKLIPYVKDLGFTHIELLPILEHPFDG
SWGYQVLGYYAPTSRFGNPTEFMAFVDRCHQSGIGVILDWVPAHFPKDGHGLALFDGTHL
YEHADSRQGEHKEWGTLVFNYGRNEVRNFLIANALFWFERYHIDGIRVDAVAAMLYLDYS
RHDGEWVANRYGGRENLEAIGFLRQLNELIFLYYPGALSIAEESTAWPLVTRPPYLGGLG
FNLKWHMGWMHDTLAYFRTDPLFRRYRHNDITFSITYTFYENFVLALSHDEVVHMKGSII
GKMPGDGWQKFANLRALFTFMYGHPGKKTLFMGMEFAHGREWNAYQSLDWHLLDYPQHRQ
MQQFVRALNRLYTGQPALYEEDCNPAGFFWVDCHDVLNSVFTFVRRGKDPSEQLLFVCNF
TPTYHPHYRVGVLETGFWQEIFNSDSGIYGGSNKGNLGGLWSENWAIHGQPYSLGLQLPP
LGCLVFKRRKEQD
Download sequence
Identical sequences Q7NL20
gi|37520875|ref|NP_924252.1| NP_924252.1.44878 251221.gvip192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]