SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520916|ref|NP_924293.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520916|ref|NP_924293.1|
Domain Number 1 Region: 190-395
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 6.93e-43
Family Integrin alpha N-terminal domain 0.0029
Further Details:      
 
Domain Number 2 Region: 46-242
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 4.05e-35
Family Integrin alpha N-terminal domain 0.0057
Further Details:      
 
Domain Number 3 Region: 401-484
Classification Level Classification E-value
Superfamily E set domains 0.000000000165
Family E-set domains of sugar-utilizing enzymes 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37520916|ref|NP_924293.1|
Sequence length 485
Comment hypothetical protein glr1347 [Gloeobacter violaceus PCC 7421]
Sequence
MSALTCSSNRQMSLASRCRWRRWWMGLGLAATMALLPLPARAQVSFETPRFFAAGERPYS
VAVGDLDGDGDLDLAVADEYSVSVLLGNGDGSFGSAVAFPVEPNSGGPRTVAAGDFDGDG
DLDLVTSNGLFSADVSVVKNNGDGTFAAPILFAAGRGPFAVVVGDFDGDGDLDVATADSG
GYPFPYYFSSVSVLDNNGNGTFAAADTISLSALPVFTVAYDIAAGDFDGDGDLDLVTANG
SGYAVTVLKNNGNGRFRLQESFGTADSSSASVATGDLDGDGDLDLAVLAYYGEVAVALNT
GDGSFGAPLGLPAGTGLQDVVLGDIDGDGQLDIVAASTSNTVSVLLNEGNALFAPASFFP
AGNFPQSVATGDFDGDGDLDLTTANFYKSVAVLLNTTSNAAPTIAAISPRFGAVDSEVTL
TGTGLGAATAVKFRSEQSRLVDAEFAVVSDSEIRAVVPAGAATGLIGITSPTGKAASPTR
FRVLP
Download sequence
Identical sequences Q7NKX9
gi|37520916|ref|NP_924293.1| NP_924293.1.44878 251221.glr1347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]