SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37520936|ref|NP_924313.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520936|ref|NP_924313.1|
Domain Number 1 Region: 132-365
Classification Level Classification E-value
Superfamily PA domain 9.94e-70
Family PA domain 0.0000287
Further Details:      
 
Domain Number 2 Region: 81-126,347-596
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.14e-65
Family FolH catalytic domain-like 0.0002
Further Details:      
 
Domain Number 3 Region: 598-626,656-774
Classification Level Classification E-value
Superfamily Transferrin receptor-like dimerisation domain 2.88e-27
Family Transferrin receptor-like dimerisation domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37520936|ref|NP_924313.1|
Sequence length 790
Comment folate hydrolase-like protein [Gloeobacter violaceus PCC 7421]
Sequence
MFSRNTRRCEDCPYNTERPVSTCLLPLFEDSMLRRSLVLSLSLVVSLIVPFTPISAQTQP
MLGFDAAGTERERKLEAQFDSLIDKNNLQNWTRRLAARPHHVGSPVQKEHAEFLVAQYRS
WGYQAEIERFDVLFPVPVTRSLELVAPMKFKAKLAEPPLKEDAGTAQAGQLPVYNAYSAD
GDVTGELVYVNFGVPKDYEELEKRGIDVKGKVVIARYGGSWRGIKPKVAAERGAIGCIIY
SDPKEDGYFQGETYPKGPWRNEYGAQRGSVADMPTHPGDPLTPGSGSVPGTKRLARKDAA
TIVKIPVLPISYADALPLLKAMGGPLAPPEWRGALPVPYRLGAGPAKVRLKLAFDWQQVP
AYNVIARLPGAELPDEWIIRGNHYDAWVLGAHDPISGTVALMEEARAIAALTKSGWKPKR
TIVYAHWDGEEPGLLGSTEWVETHADELRKKAAIYINTDSNGRGFLEMGGSHTLERYFNE
VTRDVIDPQKQIPVKERVRAGRIVGGSGEARREARERPDLRLAALGSGSDFTPFLQHLGI
ASLNLGYGGEGRGGSYHSSYDSVAYFERFIDPGYRYGTTLAQTTGRLVLRAANAEVLPFD
FVAFADTLEKYLKEVTALEGELREASLEKNRQIEEKTLEAAYDPTQPYVPPKADAPVPAM
DFAALKTAAAALRASSERYRTALDSLAARPLPPAAQKEAGAALIATERTMLRVEGLPRRP
WFRHQIYAPGLYTGYGVKTLPGVREAMEERQWSEAHEQSAILAAILERVAGQIDKATGIL
RPSQTTSAAR
Download sequence
Identical sequences Q7NKV9
gi|37520936|ref|NP_924313.1| NP_924313.1.44878 251221.glr1367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]