SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37521000|ref|NP_924377.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521000|ref|NP_924377.1|
Domain Number 1 Region: 128-492
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.8e-87
Family Amylase, catalytic domain 0.0000455
Further Details:      
 
Domain Number 2 Region: 36-122
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000373
Family AMPK-beta glycogen binding domain-like 0.013
Further Details:      
 
Weak hits

Sequence:  gi|37521000|ref|NP_924377.1|
Domain Number - Region: 496-574
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00066
Family alpha-Amylases, C-terminal beta-sheet domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37521000|ref|NP_924377.1|
Sequence length 577
Comment alpha-glucanotransferase [Gloeobacter violaceus PCC 7421]
Sequence
MSSVCNGEIMTTTKDPSESKVQPQSEAKADAKTGMIRFQLLAPYNEKAALVGSFSNWEEI
PMEKDDKGCFFVEIDLPDGEHQYKFKLVSKSFFCEGETVAIADPYARQVDEKNRENTVIR
IKDGKQITDEYVWEHDDVPLSPDDHLIIYELHVSAFGGDTFIDAIQQLDYLVDLGVNCVQ
LMPVTEYPGEHYWGYNPRHPFAPESSYGKPEDLKAFVDACHERGFRVILDIVLNHSESES
PLTRIDFTYWFYAPGTEPDEPGNVWGPKFNLEFYDEHYKRNPAREYLYDLVDYWVREYHI
DGYRIDAAAQIKYFDFLGEVARRSKANSGGKPFYLVGEHIPENPAITGADGPMDGAYHET
YYWMIDDLMVRNMFDTDQIVDSINPLHHGYPGPSNAVNFYENHDKPRLLQRLRDAGINEE
GSFKRLECAAALLMTSVGLPMLYQGQAMGQAYPQDEEVHAVEWTLLDHDRHVALLERYKG
LIDLRRETQALWTNEIDFFHIDQEARVIAYVRFNAEGSRVAVVAHLGDGNLGDYQVPCFP
EDGHWFEKTRLYEVDVEGGILNVHLSDWDVHVFRNGG
Download sequence
Identical sequences Q7NKP6
251221.gll1431 NP_924377.1.44878 gi|37521000|ref|NP_924377.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]