SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37521126|ref|NP_924503.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521126|ref|NP_924503.1|
Domain Number 1 Region: 136-304
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.83e-45
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000144
Further Details:      
 
Domain Number 2 Region: 390-503
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.79e-31
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000367
Further Details:      
 
Domain Number 3 Region: 23-135
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.8e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.00072
Further Details:      
 
Domain Number 4 Region: 273-404
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.08e-21
Family Duplicated SiR/NiR-like domains 1 and 3 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37521126|ref|NP_924503.1|
Sequence length 518
Comment ferredoxin-nitrite reductase [Gloeobacter violaceus PCC 7421]
Sequence
MERSCRYCLEGAVANPIEKIKDEKPGLAVKAELIEFARLGWEAISKGDLERLKWIGWFFR
KKTPGRWMVRLRVPGGILSSEQLRVVGGILAEFSDVKQLDITTRQNLEMRGLRIEDSVSI
QERLEAVGLTTVQSGMDNVRNIVGSPVAGIDPDELIDVRPLVQQMQDLITEGGRGSFAFS
NLPRKFNISITGDRENSAHAEINDIGFIPARREERIGFNVLVGGVLNSQRATPALPLDAF
VLPEQVAPLCAAVLRIYSDHGPREARTRARLIYLLEDWGISKFRAAVEADLGFALPPAAH
EEFIDYDKRDHVGVWPQKQAGYCFVGLHVPIGRLWAHQALEVADLAEVYGQGEVRLTVEQ
SFLIPHVAEEKLEALLVEPLLAVFSPEPNPLLRGLVSCTGAQFCNLAIIETKERALKLAH
VLASELDLPQPVRIHWSGCPNSCGQPQIGDIGLIGTRTKVAGQSVDAVDILMGGQVGREA
RFGEVVREGVPCDELAAVLKGLLIEHFGAEERPVALAS
Download sequence
Identical sequences Q7NKC1
NP_924503.1.44878 gi|37521126|ref|NP_924503.1| 251221.gvip212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]