SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37521338|ref|NP_924715.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521338|ref|NP_924715.1|
Domain Number 1 Region: 128-401
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.01e-107
Family BC ATP-binding domain-like 0.00000000815
Further Details:      
 
Domain Number 2 Region: 672-937
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 9.37e-104
Family BC ATP-binding domain-like 0.000000122
Further Details:      
 
Domain Number 3 Region: 396-552
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 6.02e-51
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.0000886
Further Details:      
 
Domain Number 4 Region: 557-674
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.45e-49
Family BC N-terminal domain-like 0.00000196
Further Details:      
 
Domain Number 5 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 7.91e-49
Family BC N-terminal domain-like 0.00000231
Further Details:      
 
Domain Number 6 Region: 939-1075
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 2.22e-38
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37521338|ref|NP_924715.1|
Sequence length 1083
Comment carbamoyl phosphate synthase large subunit [Gloeobacter violaceus PCC 7421]
Sequence
MPRRTDIHKILLIGAGPIVIGQACEFDYSGTQACKALREEGYEIVLVNSNPATIMTDPAT
ADRTYIEPVTAEFVERIIERERPDALLPTMGGQTALNVTVELAESGVLDRYGVELIGAKL
PAIKKAEDRELFKQAMEKIGLAVPRSGFAHTLEEARVVAEEIGSFPLILRPSFTLGGTGG
GIAYNREEFERMIRVGLDASPTSQVLVEESALGWKEYELEVMRDLADNVVIICSIENFDP
MGVHTGDSITVAPAQTLTDKEYQRLRDAAIKVIREIGVETGGSNIQFAVHPENGRVIVIE
MNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDEITNEITQKTPASFEPTIDYVVTKIP
RWAFEKFPGTEPVLTTAMRSVGEVMAIGRTFCESLQKALRSLEIKRFGFGADRSEEIPDA
ETLKSQLRTATPDRIFQIRQALMAGFSVEQVHELTAIDPWFLDKLAELVAFERAYQGRDL
ASLTAAEWLEAKQKGYSDMQLAFLTGTDEQSVRSTRQELGVTPVFKTVDTCAAEFEAFTP
YHYSTYASESEIASGEKPKAMILGGGPNRIGQGIEFDYCCCHACFALSEDGFETIMVNSN
PETVSTDYDTSDRLYFEPLTREDVLNIVEAEKPVGVIVQFGGQTPLNLAVPLEKAGVPIW
GTSPDSIDIAEDRERFEQLCQQLGIRQPANGMARSTADAVAVAGRIGYPVVVRPSYVLGG
RAMEIVYTDEGLGRYMAHAVQVEPDRPILIDKFLEDAVEVDVDAICDRTGQVVIGGIMEH
IEQAGIHSGDSACVLPTRTLDESVLAVIRDWTVKLARALKVVGLMNIQYAVKAHREGAEV
YVLEANPRASRTVPFVAKATGVPLAKIAARVMAGRTLEELGFTEEVIPGHIAVKEAVLPF
EKFAGTDTILGPEMRSTGEVMGIDTDFGRAFAKAQIGAGQKLPTAGTLFVSVTDRDKHAV
VPIVQQMLDLGFRVIATEGTQRFLQEQGLAVEKVLKIHEGRPHIGDLLKNRRIQLVFNTP
SGSEAQTDAQVIRRTALAQKIPVITTLAAARAVTAAIAALQKGPLEVKSLQEYHQPSLTA
GSR
Download sequence
Identical sequences Q7NJR3
NP_924715.1.44878 251221.gll1769 gi|37521338|ref|NP_924715.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]