SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37521347|ref|NP_924724.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521347|ref|NP_924724.1|
Domain Number 1 Region: 144-221
Classification Level Classification E-value
Superfamily E set domains 0.00000000000358
Family E-set domains of sugar-utilizing enzymes 0.049
Further Details:      
 
Domain Number 2 Region: 66-141
Classification Level Classification E-value
Superfamily E set domains 0.0000000000182
Family E-set domains of sugar-utilizing enzymes 0.027
Further Details:      
 
Domain Number 3 Region: 223-304
Classification Level Classification E-value
Superfamily E set domains 0.00000000154
Family Other IPT/TIG domains 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37521347|ref|NP_924724.1|
Sequence length 494
Comment hypothetical protein glr1778 [Gloeobacter violaceus PCC 7421]
Sequence
MRLTEARSGRHNPDSYSYPQFITLEVCIYMSRISGSAVFLSVALATVQPFALPLLSQEAL
AQTTSAITSFSPTSGPIGTAVVINGSGFSNVSSVKVGGGNVGFTRNSSTQVTATTNSNAK
TGPISIQTSNGLLTSSSTFTVTVNNPTISSFSPISGPPDTKVVIQGTYFNNVQSVKIGSI
YLNFVRDSETQLTTTTKTGNVSGKVTVTTTGGSAVSSASFTSDPPSITSFTPTNGTAYPA
TDVTIKGINLLNITSIGFGKGYAENWQSSSHKEVKTKIPCTASTGKIAINTYAGVISSTT
DFSVPDAGVPSDVPQRIACVKDPRTPPDGFTAITYWGQAIVDTSKTGEAIVEIDYMKLWC
TINGTEKLLADDQGSIDGQLYVRSGWYSIRETEPMPYTYNAENDSVVLPISDHPDKIFHW
YMSTPRASWSPDETVSSCRVEGRMKISGPALVQLGADWWVDAYAPWNGAQVNNREMGYSN
WYLASPDWQVIRMP
Download sequence
Identical sequences Q7NJQ4
251221.glr1778 gi|37521347|ref|NP_924724.1| NP_924724.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]