SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37521359|ref|NP_924736.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521359|ref|NP_924736.1|
Domain Number 1 Region: 41-118
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000165
Family E-set domains of sugar-utilizing enzymes 0.028
Further Details:      
 
Domain Number 2 Region: 121-197
Classification Level Classification E-value
Superfamily E set domains 0.00000000000462
Family E-set domains of sugar-utilizing enzymes 0.017
Further Details:      
 
Domain Number 3 Region: 201-272
Classification Level Classification E-value
Superfamily E set domains 0.0000000000127
Family E-set domains of sugar-utilizing enzymes 0.057
Further Details:      
 
Domain Number 4 Region: 280-360
Classification Level Classification E-value
Superfamily E set domains 0.0000000000311
Family E-set domains of sugar-utilizing enzymes 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37521359|ref|NP_924736.1|
Sequence length 550
Comment hypothetical protein glr1790 [Gloeobacter violaceus PCC 7421]
Sequence
MRLKLAFVCGFSALFALNPVQLPEHFMGLVIDQPSAWAASSPTVSSFSPTSGGPGTQVTI
NGSNFDGLENINFNGAYAAYIWVSSSQLKATVPSGATTGKIQVKTTVGSASSSSQFTVPE
VISSFSPSSGPVGTSVTINGSGFSNSVSSVKFGDGYVSFVRESAGKIQATTNTSASTGKI
IINNGGTLISSSGTFTVTTLQPRVDSFTPTNGPPGTKVVIKGANFINVNSVQIGSIYLAF
TVDSETQITATTKTGNVSGKITVTTLDNGSASSAGSFTSDPPKITSFSPMSGSAYPVTTV
TINGLNLVGISGVSFDGAPTSYRILSDKKLEAEVPCPARTGTISVKTFAGTIYSTSNFGV
QDAGVPEDIPTPIACLVTPTTPPPGFTAATYWAVALVDTAKSGTGSVEVAYTQLWCTIDG
VDTKLADDVGTLFGGLFSRDTWDGAPVSTPMPWTYNPTNNSAIVYPSENPDLFYHWYMPT
PRASWPSDASVTSCRVKTRVKISGSALLQMGGDWWLNSTAAWNGEQVNNRAMGNTNWYFP
NGEWQDITFP
Download sequence
Identical sequences Q7NJP2
gi|37521359|ref|NP_924736.1| NP_924736.1.44878 251221.glr1790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]