SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37521384|ref|NP_924761.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521384|ref|NP_924761.1|
Domain Number 1 Region: 178-258
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 8.5e-24
Family TonB 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37521384|ref|NP_924761.1|
Sequence length 261
Comment hypothetical protein glr1815 [Gloeobacter violaceus PCC 7421]
Sequence
MDSNTEPFTPFEPTSSGTASGWIIALSVIGSAVLHGGVMLLNLPEPKAPEPPPVQKMVMV
QTAPPKPPEIKQPAPPKPKPKPPEPVQTKPKSKSVAKRSAPQKAKASRPILSSKAPVQSE
TTVSENMLSGSRGTGYGTEKGEDFGSTSPVGVDGGTGGTEAVEAPPPPPPPPLVNARPKG
NVQPDYPEIAQQNNWEGRVIVKAFVNPDGTVAEVQVAKSSGHVELDNAAMEAVKRTTFEP
ARRGEEVVSAWVRVPITFSLQ
Download sequence
Identical sequences Q7NJL7
251221.glr1815 NP_924761.1.44878 gi|37521384|ref|NP_924761.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]