SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37521396|ref|NP_924773.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|37521396|ref|NP_924773.1|
Domain Number - Region: 379-445
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0408
Family Virulence factor P.69 pertactin 0.063
Further Details:      
 
Domain Number - Region: 343-387
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 0.0698
Family Iron-containing alcohol dehydrogenase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37521396|ref|NP_924773.1|
Sequence length 643
Comment hypothetical protein glr1827 [Gloeobacter violaceus PCC 7421]
Sequence
MADPSSTGRDRAMAEEMNRRESGYCRCGARRYSFVGFAASLAALLAACGGTERSELQPLA
VEPNGTSVYVQSIEAKGDLVTLGVLAINGRNEPVKLSETTDPVMLQDEAGSQYFAAKEDV
EVPPHTAAVLKIPFAGPLSRNSNNLTVRFNPRYGNRFNRPQLMVQGLPGKQGTLIDFATP
INREGPLELSAHHANGLTLALGGVRFTERDTRVAFEAINGNDREISLSRRSDLPYLEDGR
ANRYYLVPPASNPQLLVSGKQKLAGVLHFAGRVPQDVGPLTLHINERFGNPDWKEARDPK
LQIAGIAPAQTSEVAIPAEGSKPAPVAFSAPKLPEIQPVSLQVNHPNGTVLRVSSVTFAP
DAVVLDMAVTNGLKEPIQLSGAGDMLLTDDLGNPYLPTPPPDNQALNVAPGATLKGRFTF
LGRVAPGASRLTLTTNSVYGSDDWSRSTKPKMIVGGISIGQSQAVASTPLAAGAAQSGAS
AVPGPDSAAAPSTPAESMPQAAAPAGPTPPQPPAGGNTIEVNLQTNHPNGSVMRLSKVTY
NEDNIALEMTVTNGHNEQIQLNFRDDMLVKDDLGNRYNPAPPPSNPKVTVNPGATIKGQF
VFIGRIAPGARNITLTTNSVLGSDWKRSDRPKMIISGIPVGGS
Download sequence
Identical sequences Q7NJK5
251221.glr1827 gi|37521396|ref|NP_924773.1| NP_924773.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]