SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37521400|ref|NP_924777.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521400|ref|NP_924777.1|
Domain Number 1 Region: 1-206
Classification Level Classification E-value
Superfamily Formyltransferase 4.45e-64
Family Formyltransferase 0.00000211
Further Details:      
 
Domain Number 2 Region: 204-308
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 2.94e-23
Family Post formyltransferase domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37521400|ref|NP_924777.1|
Sequence length 310
Comment methionyl-tRNA formyltransferase [Gloeobacter violaceus PCC 7421]
Sequence
MRVVYFGTAEFAVPTLEALLAAREIEVVAAVSQPDRPQGRGNRLTPPPVKAIAQSRGIPV
FQPDRLRKDLEVLAHLEALQADFFVVAAYGQILPQRVLDMPGRGCINVHGSLLPKYRGAA
PVQWAIYHGEPETGITTMLMEAGLDTGPMLKKIAVPIDEDITGEQLLAQLAHLGAGLLLE
TLREFDRITPEPQDDSLSSYAPLIDKGQYLVDWGQSARQIRNQIRAFYPYTHTFHRGSRL
RLLAAELTSTGSEQFQPSAIIHVIKSKGFEVVTGDGALLLTRVQPAGGKEQPAWDYANGC
RLMPGESLGL
Download sequence
Identical sequences Q7NJK1
NP_924777.1.44878 gi|37521400|ref|NP_924777.1| 251221.gvip252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]