SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37521405|ref|NP_924782.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521405|ref|NP_924782.1|
Domain Number 1 Region: 2-245,366-413
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.86e-79
Family Tandem AAA-ATPase domain 0.00000019
Further Details:      
 
Domain Number 2 Region: 723-943
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 3.14e-66
Family Helical scaffold and wing domains of SecA 0.0000134
Further Details:      
 
Domain Number 3 Region: 416-523,621-721
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.92e-52
Family Tandem AAA-ATPase domain 0.00000874
Further Details:      
 
Domain Number 4 Region: 248-366
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 9.29e-44
Family Pre-protein crosslinking domain of SecA 0.0000556
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37521405|ref|NP_924782.1|
Sequence length 952
Comment preprotein translocase subunit SecA [Gloeobacter violaceus PCC 7421]
Sequence
MAWWNKLFGDPQERKVKKYQPRVAEMNALEAEVAALSDDQLRAKTAVFQKRVADQLQGVD
LDALEIRERRRRIDVALDGVISEAFAVVREAAKRVIGLRHYDVQLIGGLVLHEGQIAEMK
TGEGKTLVATLPAYLNALTGRGVHIVTVNDYLARRDSEWMGQVHRFLGLSVGLIQQSMTP
SERAQNYAADITYGTNSELGFDYLRDNMATNAGELVQRSFNYCIIDEVDSILVDEARTPL
IISGMVAKPAEKYMRANEVATALERNTHYEVDEKQRNVTLTDEGFIAAEQMLSTEDLFSP
RDPWAHFVFNAVKAKELFNKDVQYIVRNDEVVIVDEFTGRVMPGRRWSEGLHQAVEAKEM
VTIQNETQTMASITYQNFFLLYPKLAGMTGTALTEEAEFGKIYSLEVTAIPTNRKVVRTD
MSDQVYKTENGKWQSVAAEIAEMNKNGRPVLVGTTSVEKSEVLSALLKEKGIAHNLLNAK
PENVERESEIVAQAGRKGGVTIATNMAGRGTDILLGGNPEYMARLKLKEVLFPALVIDDE
DAFSPMMRLLNNGNSRGTGFAATSKKKALPKAEIFPCELSESTKQQLKAAVDYAVAMLGA
DSQPALQVEELIAVASEKGPTDDPVIQHLREIYRAIYKEYQVVTDREHDEVVKLGGLHVI
GTERHEARRVDNQLRGRSGRQGDPGSTRFFLSLGDNLLRIFGGERVAGLMEAFKVEEDMP
IESGLLTKSLENAQRKVETFYYDQRKQVFEYDEVMNNQRKAIYAERRRALEGQDLSAVVR
EYIDQTVDEIVRAHVNAERPPEEWELPALIQDLQQLIPLLENQLDAVKLGEFSAVELEED
LKSQALLAYETREEYINAIQPDLMREAERYFILNQIDTLWREHLQQMDSLREMIGLRGYG
QKDPLIEYKNEGYELFLQMLVEVRRNVVFALYHFQPQYNPPIDPDYVDSEYV
Download sequence
Identical sequences Q7NJJ6
NP_924782.1.44878 251221.gvip253 gi|37521405|ref|NP_924782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]