SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37521438|ref|NP_924815.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521438|ref|NP_924815.1|
Domain Number 1 Region: 24-131
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 4.84e-17
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37521438|ref|NP_924815.1|
Sequence length 135
Comment cytochrome b6-f complex subunit 4 [Gloeobacter violaceus PCC 7421]
Sequence
MYTQQEKQNSSKTLPAVGRSLDTRVFDIALVVIASIGVALVLTVLEPPRLIEAYDVFATP
EVLPEWYMLPAFFIIKALPAKILGLAAMAGVVAGLFLLPLLPDLGKRLPGGRFLGRAAFV
AIHLGVAVLGFLTLV
Download sequence
Identical sequences Q7NJG3
NP_924815.1.44878 251221.gvip257 gi|37521438|ref|NP_924815.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]