SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37521497|ref|NP_924874.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521497|ref|NP_924874.1|
Domain Number 1 Region: 112-295,432-586
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.19e-106
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000512
Further Details:      
 
Domain Number 2 Region: 1-106
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.95e-30
Family Anticodon-binding domain 0.00011
Further Details:      
 
Domain Number 3 Region: 292-427
Classification Level Classification E-value
Superfamily GAD domain-like 1.64e-28
Family GAD domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37521497|ref|NP_924874.1|
Sequence length 595
Comment aspartyl-tRNA synthetase [Gloeobacter violaceus PCC 7421]
Sequence
MRSDYCGTLRSEHIGKTVSLYGWIDGWRDHGGVIFLDLRDYTGIVQIVADPQRTPESYHL
ASSLRNEYVVRVEGRVSARPEHSLNPRLSTGTVEVYADTLAVLNRAETPPFAISKDEEVD
EKLRLKFRYLDLRRGRMQKLLRLRHRVMQIMRRHLDERGFTEIETPVLVKSTPEGARDYL
VPSRVNPGDWFALPQSPQLFKQLLMVAGFDRYYQIARCFRDEDLRADRQPEFTQLDMEMS
FLSMEEIIALNEGLVAAILQETMGLELSLPLPRLTYAEAMVRYGSDKPDTRFGLELVEVS
EVFRESSFQVLSGAVAAGGKVVCLPVPGAEGITNTRVKPGGDLFEFVTQFGARGLLFARV
REGGQVDTIGAFSKSLTPEIAAGMIEKTGAQPGHLLLFGAGDRTAVPTVLDYMGRLRLKM
GEELGLIDPNRHNLLWVTDFPMFEWNAEEKRLEALHHPFTAPRPEDEHDLKTARALAYDI
IWNGVEVGGGSLRIYRRALQERVFETIGLTEEEARAKFGFLLDAFEYGTPPHGGIAYGFD
RFVMLIAGEQSIREVIAFPKTQRAQDLMLGAPSAVAERQLKELNVRSTLPPKTQG
Download sequence
Identical sequences Q7NJA4
251221.gvip266 gi|37521497|ref|NP_924874.1| NP_924874.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]