SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37521535|ref|NP_924912.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521535|ref|NP_924912.1|
Domain Number 1 Region: 68-208
Classification Level Classification E-value
Superfamily FtsH protease domain-like 0.00000000000000275
Family FtsH protease domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37521535|ref|NP_924912.1|
Sequence length 229
Comment hypothetical protein gll1966 [Gloeobacter violaceus PCC 7421]
Sequence
MGDRTGLLAVLALLVTVLAGLGPALGLSPAIAAFLVAVGLGSFFIDQFFLQGRLSVLLVG
LIQERRPGWRERVARHEAGHLLVAHRLGLPVEGYTLGAWESFRRGQGGGGGVILGSPPAR
LGIEGIESYCATWLAGALAERMYYSEAVGAVEDQQKVGLLLAAAQRTGAVAARTLRNRAE
RRAAAILDAERQTHNALAERMLTGQSLERCLQLLNSTKDAASSDSAVQA
Download sequence
Identical sequences Q7NJ66
gi|37521535|ref|NP_924912.1| 251221.gll1966 NP_924912.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]