SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37521545|ref|NP_924922.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521545|ref|NP_924922.1|
Domain Number 1 Region: 123-268
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.18e-42
Family Pentapeptide repeats 0.00026
Further Details:      
 
Domain Number 2 Region: 48-107
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000000183
Family Pentapeptide repeats 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37521545|ref|NP_924922.1|
Sequence length 274
Comment hypothetical protein gll1976 [Gloeobacter violaceus PCC 7421]
Sequence
MFIVDYFRDIFRDLYLAWQHDRDAAAQDKQTVHNAQELLERYARGERYFVLADLEKEDLR
NVELPGAHFIRAFLKGADLRGANLIGATFDHYTDLEGMLIDEKTQLDPKWRTVWELVNLP
PVTGRQLPGADLSSTQLTGVHLQRANLAGTDLSGACLDEAKLQEANLEGAILREARFVSA
NLRGVNLRGADCQEAKLFDANLCDTDLREANLSKANLIEAVLVGADLRGADLRGANLDSA
NCKGANLEGANLEGANLAQVLLAGATMPDGSIHP
Download sequence
Identical sequences Q7NJ56
251221.gll1976 NP_924922.1.44878 gi|37521545|ref|NP_924922.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]