SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37521581|ref|NP_924958.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521581|ref|NP_924958.1|
Domain Number 1 Region: 85-354
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.47e-76
Family BC ATP-binding domain-like 0.000001
Further Details:      
 
Domain Number 2 Region: 2-115
Classification Level Classification E-value
Superfamily PreATP-grasp domain 5.76e-47
Family BC N-terminal domain-like 0.0000271
Further Details:      
 
Domain Number 3 Region: 333-447
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 3.4e-45
Family BC C-terminal domain-like 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37521581|ref|NP_924958.1|
Sequence length 449
Comment acetyl-CoA carboxylase biotin carboxylase subunit [Gloeobacter violaceus PCC 7421]
Sequence
MVYFRKILIANRGEVALRILRTCSELGIGTVAVHSTADALSLHVQLADQAVCIGEPMASK
SYLSIPNLISAALTRDCDAVHPGYGFLSENERFAEICADHGLTFIGPSPRAMVLMGDKST
ARDTMKAAGVPTVPGSEGLIDSEQEAYEAAKAIGYPVMIKATAGGGGRGMRIAGNERDLI
KMVQTAQREAEAAFGNRGVYIEKYLEEPRHIEFQILADQHGNVVHLGERDCSIQRRHQKL
LEESPSPFLTPAMRERMGEAALQAARSINYVGAGTIEFLVDKKGDFYFMEMNTRIQVEHP
VTEMRTGIDLIAEQIRIAAGEPLGYTQSDIRMEGHAIECRINCEDPNNDFRPTPGTISAY
LAPGGPGVRMDSHLYPGYKVPSHYDSLLGKLIVWGRNRDEAIRRMRRALAECAITGVPTT
IPFHLRVLDNAWFLRGDVYTNFVQRRMSE
Download sequence
Identical sequences Q7NJ20
gi|37521581|ref|NP_924958.1| NP_924958.1.44878 251221.gvip271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]