SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37521619|ref|NP_924996.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521619|ref|NP_924996.1|
Domain Number 1 Region: 38-498
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 1.7e-160
Family Type II DNA topoisomerase 0.00000000099
Further Details:      
 
Domain Number 2 Region: 514-823
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 7.72e-71
Family GyrA/ParC C-terminal domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37521619|ref|NP_924996.1|
Sequence length 825
Comment DNA gyrase subunit A [Gloeobacter violaceus PCC 7421]
Sequence
MPRQLELTGPEPKARVVPTALHSEMQRSYLEYAMSVIVGRALPDVRDGLKPVHRRILFAM
HELGLAPDRPFRKCARVVGDVLGKYHPHGDTAVYDALVRLVQDFSSRYPLLSGHGNFGSI
DNDPPAAMRYTECRLAAVGVDALLAEIDDQTVEFTDNFDGSQREPEVLPARLPVLLLNGS
AGIAVGMATNIPPHNLGELVDGLVALIDNPELADEQLLRIIPGPDFPTGGQIIGTEGIRE
AYLTGRGSITMRGITHCEEVGSGRRRKPAIIVTALPYQVNKAAWIEKVAELVNLGKVNGI
SDLRDESNREGVRVVLEMKREARPEAILAGLYRLTPLQANFGTILLTLVGGQPRLLKLRE
LLEQFLEFRVATLTRRIQYNLRRASERAHQLEGQLVALANLQPIVQMLSAARDAAQARAE
LEASYGLSERQSEEILQMPLRRLTQLDRERLASEHRELREKVIELQSQLDSRRKLLGLLK
RELRDLKKKHADPRRTCIEARTAPLPTLAEITSDDEVVVQLTHRGYVRRIPAAAFERRSR
SRRAVSRTEDNDFVVESYPTRTRNELLVITRSGRAYSLKVSEIPETGPRSRGTPLVTLLS
IQGEQIAATFVRENYPPDLFLVLLTREGRIKKLLLSECANLTGRGLMMLKLSEEDQLIQV
GLATAHSQIVVGTSAGRLLRFVADEAQLPAMGRSALGLQAIKLRRGESLAAMTVVGNGED
LLMVSRLGLGKRLKTGEIRLQERAGLGTPVGLLRERNGDSLLAVLAVGAEGEVAMATDQE
RLVQVDLGELAATDRSSPGKPLAVLNPAEQIIAVTRLSAEPEETD
Download sequence
Identical sequences Q7NIY2
NP_924996.1.44878 251221.gvip274 gi|37521619|ref|NP_924996.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]