SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37521647|ref|NP_925024.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521647|ref|NP_925024.1|
Domain Number 1 Region: 415-493
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000662
Family E-set domains of sugar-utilizing enzymes 0.036
Further Details:      
 
Weak hits

Sequence:  gi|37521647|ref|NP_925024.1|
Domain Number - Region: 292-471
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000628
Family Galacturonase 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37521647|ref|NP_925024.1|
Sequence length 495
Comment hypothetical protein glr2078 [Gloeobacter violaceus PCC 7421]
Sequence
MATVLQVPMLCPSRRSLPALLALLVFVFANPPLLWAAPTPAAVPPPKTPAPLQATLELQA
NQNYGRLPVSFEPNVGQTDERVKFLARAGGHRVFLMPAEAVFVPGSRPKRNLPKLDARPQ
SGPTQLEASGPASVVRMELVGANRDALMEGLSPLPGKVNYLKGNNPKQWRTNIGTYGRVR
VQAVYRGIDLVYHSDNGRLEYDFVVAPGANPGRIRLRFGGGQKVLIDKDGALVVKTQVGE
VRQPRPVVYQRFGAGRRVVPGQYVQSNDKTVGFQLGRYDRTRPLVIDPTLAYSTYLGGND
YDFGTSIAVDGAGNAYVTGYTYSTNFPAANALQPTIKGTNDVFVSKLNASGNALVYSTYL
GGSDDDDYTGIAVDEAGNAYVEGNTASTNFPTANALQLTNKGKSDVFVSKIDISKPNITG
FSPTSGAIGTAVTVTGVGFANATRVDFANQTPAPFTIVSDNEIVATVNAGSKTGKIVVLV
PNGRTSSPTKFTVTP
Download sequence
Identical sequences Q7NIV4
gi|37521647|ref|NP_925024.1| NP_925024.1.44878 251221.glr2078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]