SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37521740|ref|NP_925117.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521740|ref|NP_925117.1|
Domain Number 1 Region: 113-419
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 5.75e-42
Family Galactose oxidase, central domain 0.0002
Further Details:      
 
Domain Number 2 Region: 419-519
Classification Level Classification E-value
Superfamily E set domains 1.54e-26
Family E-set domains of sugar-utilizing enzymes 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37521740|ref|NP_925117.1|
Sequence length 749
Comment hypothetical protein glr2171 [Gloeobacter violaceus PCC 7421]
Sequence
MPKFKATRLLRRRQLLKLAVFTGVGSALYFVADRQRATFAQEDTQGLWQVLPFDSQILAV
HAALLRTGKVLFVAGSSNDETNIPFEHGSVVLDINAPDGNPVFPADLLNSQGKQIDLFCC
AHAALADGRILFGGGTKQYDPFYGINEAITFDPQTQKWTKVNSMAIGRWYPTYTTLGDGR
VLAVSGFDGGGKYTLVPEIFSTATGNWSSLAKTAKTWPLYAHLYLLRDGRIFYAGGYYGS
YVANQNTLPPTLWNMTTNATTTVGGLTSTTLRSQAASVLLPPAQDQKVLLIGGGPATGTG
SATRDVNIVNLAVSSPVYTKVASLNFARLHHSAVLLPDRTVLVCGGSGADEDAAKAALQA
EIYDPVANTWKVAATATVARLYHSIALLLPDGRVITAGSNPEREVEELRLEVFSPPYLFR
GPRPVIESVAQSWNYGNAVEIKTPQATDIRWISLIRPGTPTHAFDMDQRLVDVPFTLNTS
GGLTATIPSEPNLAPPGWYMLFITDNDKVPSVAAWVQLKPSTSPTTFSLQSSTSPGRSGP
TPLQGKTVSGNLYVFLTPESGVTQVRFFLDNPSGSGTPTQVENTAPYDFKGGSATQANPF
DTKTISDGQHTITASISLSAGGTQTVSSTFTVANSGPPPSTFSLQSSTSPGRSGPTPLQG
KTVSGNLYVFLTPESGVTQVRFFLDNPSGSGTPTQVETVAPFDFKGGTTTAARPFDTKTV
SNGSHTITASVTLSSGTIQTTSATFTVAN
Download sequence
Identical sequences Q7NIL2
251221.glr2171 NP_925117.1.44878 gi|37521740|ref|NP_925117.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]