SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37521850|ref|NP_925227.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521850|ref|NP_925227.1|
Domain Number 1 Region: 3-245
Classification Level Classification E-value
Superfamily Hsp33 domain 1.07e-66
Family Hsp33 domain 0.0000019
Further Details:      
 
Domain Number 2 Region: 236-295
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 1.26e-19
Family HSP33 redox switch-like 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37521850|ref|NP_925227.1|
Sequence length 306
Comment heat shock protein 33 [Gloeobacter violaceus PCC 7421]
Sequence
MADQLVRATAAQGRIRAVGVLSTRLTEEARGRHKLSYVATAALGRTMAAGLLIASNFKQT
EARVNLRLQGDGPLGGILVDAGADGTVRGYVKNPQVELPPSPKGKLDVGRAVGANGFLYV
VKDLGYGYPFSGTTELVSGEIGDDVTHYLVTSEQVASALMLGVFVGADGVDAAGGLLLQV
MPSADGQEDEELAATLERRLASVEGFTPLVRSGKRIPQILEELLGDMGLEIFPEVQLVRF
HCHCSPQRVLGALKMMGEAELLDMIEKDGGAEATCHFCNQVYQVKASELETLVEQLRSER
EVSSQE
Download sequence
Identical sequences Q7NIA2
251221.gvip309 gi|37521850|ref|NP_925227.1| NP_925227.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]