SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37522008|ref|NP_925385.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522008|ref|NP_925385.1|
Domain Number 1 Region: 160-391
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.18e-38
Family Integrin alpha N-terminal domain 0.0039
Further Details:      
 
Domain Number 2 Region: 398-476
Classification Level Classification E-value
Superfamily E set domains 0.0000000187
Family E-set domains of sugar-utilizing enzymes 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37522008|ref|NP_925385.1|
Sequence length 488
Comment hypothetical protein gll2439 [Gloeobacter violaceus PCC 7421]
Sequence
MRDVTMANTFDASAILRLAPGPGWGWILGLGLAGTVALWAVPARAQVDFAPPATFAAGAG
PYAAALGDLDDDGDLDIVTANSDSDNVTVLLGDGRGSFAAVGTFAVGGSEPESVALGDID
GDGDLDIVTADSDFNAAGLSVLANQGNGSFAAPNRLLVAGFPDFVTLGDMDNDTDTDILA
LASNSGDLTVLFNNGSGGFAMSATYSVGELPQSAALSDIDADGDLDIAVVDSRSDQVSVL
LNDGRGGFAPAGNFAVDGPTSLALGDVDGDGDLDIVTANYFSDTGGGVAVLLGDGRGNFG
PRRDFLATGASFAGLTDLDSDGDLDIVSNNAGDNQALVLLGNGRGNFTVATPFATGGVGP
FGVALGDIDADGNPDIVAANVGSDNVAVLLNTFELGATPTITALNLPFGRPGIGVFIHGT
GFTGISSVTFEKLGPGRVPAQFTVVSSTEINAVVPVGTASGRIVITTASGKIAISPQRFT
AIRPPFGK
Download sequence
Identical sequences Q7NHU6
gi|37522008|ref|NP_925385.1| 251221.gll2439 NP_925385.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]