SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37522028|ref|NP_925405.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522028|ref|NP_925405.1|
Domain Number 1 Region: 116-217
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000589
Family Collagen-binding domain 0.013
Further Details:      
 
Domain Number 2 Region: 227-331
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000183
Family Collagen-binding domain 0.01
Further Details:      
 
Weak hits

Sequence:  gi|37522028|ref|NP_925405.1|
Domain Number - Region: 95-102
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0418
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37522028|ref|NP_925405.1|
Sequence length 342
Comment hypothetical protein gll2459 [Gloeobacter violaceus PCC 7421]
Sequence
MARRALPRGGVDKPVVKKRIDEQLWFRAGTGLTATVGLGLLLNWAGPSLVKLPVAGQVFL
QLCRVVNATCEDTGGGLQASSRPDPKPTDRLGVVPPPPPPPPEEHEADLAALQSDSQGNS
LATAIAVDNLDGKQPLRGETNPIDRQDFYRFTLNGPSTVQVLADGTAAAAAILDASGKEI
LTAERGPAGVAIDRSLKAGTYYAWVRGSRRRVGTYNLMLTASAIDSRPGDDTLSTATHVG
ILGEAQNFKDWVGSADEEDFFRFELASESRLNLMLEGRVAHASLLDRNGERLERSDRTDF
GDTLGRTLEAGVYYLHIERDSRKEGAYTLNLSASLEEADAES
Download sequence
Identical sequences Q7NHS6
251221.gll2459 NP_925405.1.44878 gi|37522028|ref|NP_925405.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]