SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37522184|ref|NP_925561.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522184|ref|NP_925561.1|
Domain Number 1 Region: 36-229
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.83e-56
Family Class I glutamine amidotransferases (GAT) 0.00000556
Further Details:      
 
Domain Number 2 Region: 217-444
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.15e-55
Family N-type ATP pyrophosphatases 0.00000194
Further Details:      
 
Domain Number 3 Region: 431-551
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 1.09e-51
Family GMP synthetase C-terminal dimerisation domain 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37522184|ref|NP_925561.1|
Sequence length 551
Comment GMP synthase [Gloeobacter violaceus PCC 7421]
Sequence
MTSSPTAAARTEGEAAPTVPTQVESGTAQRPGLAREMVAILDFGSQYSELIARRIRETKV
YSEVLSYQTPIAEIRRLAPKGIILSGGPNSVYEAYAPQCDPALWELGIPILGVCYGMQLM
VQQLGGAVERAERAEYGKASLFINDPTDLFTNVEDGTTMWMSHADSVLRMPEGFELLAHT
ENTPCAAIAHHSRHLYGVQFHPEVVHSRGGMALLRNFVYHICGCEPEWTTAAFIEEAIRE
VRARVGDKRVLLALSGGVDSSTLAFLLHRAIGDNLTCMFIDQGFMRKNEPERLVKLFKEQ
FHIPVAYVDAAERFIVRLEGVSDPEQKRKIIGAEFIRVFESESQRLGPFDYLAQGTLYPD
IIESAGENIDPKTGERVAVKIKSHHNVGGLPENLRFKLVEPLKRLFKDEVRQVGRALGLP
EEIVQRQPFPGPGLAIRVLGELTKDKVDILREADFILRQEVNRSGRYNDYWQSFAVLLPV
KTVGVMGDRRTYAYALALRFVTSEDGMTADWARVPYDLLEQIANRIVNEVPGINRVVLDI
TSKPPGTIEWE
Download sequence
Identical sequences Q7NHC2
NP_925561.1.44878 251221.gvip362 gi|37522184|ref|NP_925561.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]