SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37522195|ref|NP_925572.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522195|ref|NP_925572.1|
Domain Number 1 Region: 53-207
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.28e-41
Family Pentapeptide repeats 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37522195|ref|NP_925572.1|
Sequence length 252
Comment hypothetical protein glr2626 [Gloeobacter violaceus PCC 7421]
Sequence
MGADAAADTLKDRRRPKSYNGQRLSPFWSKPVGHPSAKTALIERIRSGEAPLIDLSEADL
LRADLQGVNLVGSNLERAALVLANLRGARLTGADLHRASLVGAVLEETDLGAACLRDADL
TAVSGGRAVLEKADLSRANLRGADLGGANLREADLSRADLRGANLRGADLRGANLRDSSL
EEACLSAANLAGADFSRSCLRGAAFDETGEAVGADFYECRELDPAWASGLIELGALNVEP
PSDRERRLISPQ
Download sequence
Identical sequences Q7NHB1
gi|37522195|ref|NP_925572.1| NP_925572.1.44878 251221.glr2626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]