SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37522217|ref|NP_925594.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522217|ref|NP_925594.1|
Domain Number 1 Region: 28-166
Classification Level Classification E-value
Superfamily RNase III domain-like 2.09e-34
Family RNase III catalytic domain-like 0.00028
Further Details:      
 
Domain Number 2 Region: 125-233
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 4.71e-17
Family Double-stranded RNA-binding domain (dsRBD) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37522217|ref|NP_925594.1|
Sequence length 242
Comment ribonuclease III [Gloeobacter violaceus PCC 7421]
Sequence
MAESALTPLRLAQLRRFAARFALSEPEALSWELLHRALIHPSWSAQEGGEDNDRLEFLGD
EILRLLAAEFLYRADPELTVGEMTAVRSVLVSDVALAELAEGYDLGEFLVVGRSASGDER
GRITRLADGFEAVIGALYLSTGDLGLIRPWLLPHLAHLAESVMADPTRGNHKSALQELTQ
KLAAGELPEYRLVDPGPPFRYEVWALGRLWGSGEGPSKKLAQQRAARGAYAALRSAFDTA
LQ
Download sequence
Identical sequences Q7NH89
251221.gvip371 gi|37522217|ref|NP_925594.1| NP_925594.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]